PTM Viewer PTM Viewer

AT2G48130.1

Arabidopsis thaliana [ath]

Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein

No PTMs currently found

PLAZA: AT2G48130
Gene Family: HOM05D000489
Other Names: NULL

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 183

MGYRRSYAITFVALVAALWSVTKAQPSSSCVSTLTTLSPCLSYITGNSTTPSQPCCSRLDSVIKSSPQCICSAVNSPIPNIGLNINRTQALQLPNACNIQTPPLTQCNAATGPTAQPPAPSPTEKTPDVTLTPTSLPGARSGVGGGSKTVPSVGTGSSSRNVDPLPLHFLMFAVLVVCTSSFL

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR016140 17 107
Molecule Processing
Show Type From To
Propeptide 159 183
Signal Peptide 1 24

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here